Quick search:







Description Entry page for Effector - 'Adenylate cyclase 1-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 1
Cross References:
References
UniProtQ08828 | A4D2L8 | Q75MI1
EMBLAC069008 | AC091439 | CH236960 | L05500
InterProIPR001054 | IPR018297
PRODOM
GENEID107
MIM103072
PRINTS
PFAMPF00211
Details:
Details
NameAdenylate cyclase 1-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 1; EC=4.6.1.1;AltName: Full=Adenylate cyclase type I;AltName: Full=ATP pyrophosphate-lyase 1;AltName: Full=Adenylyl cyclase 1;AltName: Full=Ca(2+)/calmodulin-activated adenylyl cyclase
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY
FunctionThis is a calmodulin-sensitive adenylyl cyclase
Fragment0
Sequence
MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLSSGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAV
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRA
GLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-5_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
2Ggamma-8_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
3Gbeta-1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
4Gbeta-like_Homo sapiens_1Inhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
5Ggamma-7_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
6Ggamma-t2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
7Gbeta-2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
8Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
9Galpha-o_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
10Gbeta-like_Homo sapiens_2Inhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
11Ggamma-12_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
12Galpha-i2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
13Ggamma-t1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
14Gbeta-3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
15Galpha-i3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
16Ggamma-3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
17Ggamma-5_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
18Gbeta-4_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
19Ggamma-4_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
20Ggamma-2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
21Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
22Ggamma-10_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
23Galpha-i1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
24Ggamma-13_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
25Ggamma-11_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933 | 10449730
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level