Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 10-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 10
Cross References:
References
UniProtP78508 | Q5VUT9 | Q8N4I7 | Q92808
EMBLU73192 | U73193 | U52155 | AL513302 | BC034036
InterProIPR016449 | IPR001838 | IPR003269 | IPR013521 | IPR013518
PRODOMPD001103
GENEID3766
MIM602208
PRINTSPR01322 | PR01320
PFAMPF01007
Details:
Details
NameATP-sensitive inward rectifier potassium channel 10-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 10;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 10;AltName: Full=Inward rectifier K(+) channel Kir1.2;AltName: Full=ATP-dependent inwardly rectifying potassium channel Kir4.1;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ1
FunctionMay be responsible for potassium buffering action ofs glial cells in the brain
Fragment0
Sequence
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
2Gbeta-1_Homo sapiensStimulation15251227 | 10990455
3Ggamma-13_Homo sapiensStimulation15251227 | 10990455
4Gbeta-2_Homo sapiensStimulation15251227 | 10990455
5Ggamma-5_Homo sapiensStimulation15251227 | 10990455
6Gbeta-4_Homo sapiensStimulation15251227 | 10990455
7Ggamma-10_Homo sapiensStimulation15251227 | 10990455
8Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
9Gbeta-5_Homo sapiensStimulation15251227 | 10990455
10Ggamma-2_Homo sapiensStimulation15251227 | 10990455
11Ggamma-7_Homo sapiensStimulation15251227 | 10990455
12Gbeta-3_Homo sapiensStimulation15251227 | 10990455
13Ggamma-4_Homo sapiensStimulation15251227 | 10990455
14Ggamma-12_Homo sapiensStimulation15251227 | 10990455
15Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
16Ggamma-11_Homo sapiensStimulation15251227 | 10990455
17Ggamma-3_Homo sapiensStimulation15251227 | 10990455
18Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
19Ggamma-8_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level