Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 11-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 11
Cross References:
References
UniProtQ14654 | Q2M1H7 | Q58EX3
EMBLD50582 | BC064497 | BC112358
InterProIPR016449 | IPR001838 | IPR003279 | IPR013521 | IPR013518
PRODOMPD001103
GENEID
MIM600937 | 601820 | 606176 | 610582
PRINTSPR01332 | PR01320
PFAMPF01007
Details:
Details
NameATP-sensitive inward rectifier potassium channel 11-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 11;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 11;AltName: Full=Inward rectifier K(+) channel Kir6.2;AltName: Full=IKATP;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ1
FunctionThis receptor is controlled by G proteins
Fragment0
Sequence
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-1_Homo sapiensStimulation15251227 | 10990455
2Gbeta-4_Homo sapiensStimulation15251227 | 10990455
3Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
4Gbeta-5_Homo sapiensStimulation15251227 | 10990455
5Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
6Ggamma-3_Homo sapiensStimulation15251227 | 10990455
7Ggamma-10_Homo sapiensStimulation15251227 | 10990455
8Ggamma-2_Homo sapiensStimulation15251227 | 10990455
9Ggamma-7_Homo sapiensStimulation15251227 | 10990455
10Ggamma-11_Homo sapiensStimulation15251227 | 10990455
11Gbeta-2_Homo sapiensStimulation15251227 | 10990455
12Ggamma-8_Homo sapiensStimulation15251227 | 10990455
13Ggamma-12_Homo sapiensStimulation15251227 | 10990455
14Ggamma-5_Homo sapiensStimulation15251227 | 10990455
15Ggamma-4_Homo sapiensStimulation15251227 | 10990455
16Gbeta-3_Homo sapiensStimulation15251227 | 10990455
17Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
18Ggamma-13_Homo sapiensStimulation15251227 | 10990455
19Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level