Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 12-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 12
Cross References:
References
UniProtQ14500 | O43401 | Q15756 | Q8NG63
EMBLL36069 | U53143 | AB074970 | AB182123 | BC027982 | AF005214
InterProIPR016449 | IPR001838 | IPR003272 | IPR013521 | IPR013518 | IPR013673
PRODOMPD001103
GENEID100131509 | 100290070 | 3768
MIM602323
PRINTSPR01325 | PR01320
PFAMPF01007 | PF08466
Details:
Details
NameATP-sensitive inward rectifier potassium channel 12-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 12;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 12;AltName: Full=Inward rectifier K(+) channel Kir2.2;AltName: Full=Kir2.2v;AltName: Full=IRK2;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ12 | IRK2,KCNJN
FunctionProbably participates in establishing action potentials waveform and excitability of neuronal and muscle tissues
Fragment0
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRESEI
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-1_Homo sapiensStimulation15251227 | 10990455
2Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
3Ggamma-11_Homo sapiensStimulation15251227 | 10990455
4Ggamma-7_Homo sapiensStimulation15251227 | 10990455
5Ggamma-10_Homo sapiensStimulation15251227 | 10990455
6Ggamma-3_Homo sapiensStimulation15251227 | 10990455
7Gbeta-4_Homo sapiensStimulation15251227 | 10990455
8Ggamma-13_Homo sapiensStimulation15251227 | 10990455
9Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
10Ggamma-2_Homo sapiensStimulation15251227 | 10990455
11Gbeta-2_Homo sapiensStimulation15251227 | 10990455
12Ggamma-12_Homo sapiensStimulation15251227 | 10990455
13Gbeta-5_Homo sapiensStimulation15251227 | 10990455
14Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
15Ggamma-5_Homo sapiensStimulation15251227 | 10990455
16Gbeta-3_Homo sapiensStimulation15251227 | 10990455
17Ggamma-4_Homo sapiensStimulation15251227 | 10990455
18Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
19Ggamma-8_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level