Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 14-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 14
Cross References:
References
UniProtQ9UNX9
EMBLAF081466 | AF181988 | BC035918
InterProIPR016449 | IPR001838 | IPR013521 | IPR013518
PRODOMPD001103
GENEID3770
MIM603953
PRINTSPR01320
PFAMPF01007
Details:
Details
NameATP-sensitive inward rectifier potassium channel 14-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 14;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 14;AltName: Full=Inward rectifier K(+) channel Kir2.4; Short=IRK4;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ1
FunctionInward rectifier potassium channels are characterized bys a greater tendency to allow potassium to flow into the cell rathers than out of it
Fragment0
Sequence
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-5_Homo sapiensStimulation15251227 | 10990455
2Gbeta-2_Homo sapiensStimulation15251227 | 10990455
3Gbeta-5_Homo sapiensStimulation15251227 | 10990455
4Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
5Ggamma-2_Homo sapiensStimulation15251227 | 10990455
6Ggamma-11_Homo sapiensStimulation15251227 | 10990455
7Ggamma-10_Homo sapiensStimulation15251227 | 10990455
8Ggamma-4_Homo sapiensStimulation15251227 | 10990455
9Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
10Gbeta-3_Homo sapiensStimulation15251227 | 10990455
11Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
12Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
13Gbeta-1_Homo sapiensStimulation15251227 | 10990455
14Ggamma-8_Homo sapiensStimulation15251227 | 10990455
15Ggamma-3_Homo sapiensStimulation15251227 | 10990455
16Ggamma-7_Homo sapiensStimulation15251227 | 10990455
17Ggamma-13_Homo sapiensStimulation15251227 | 10990455
18Ggamma-12_Homo sapiensStimulation15251227 | 10990455
19Gbeta-4_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level