Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 15-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 15
Cross References:
References
UniProtQ99712 | O00564 | Q96L28 | Q99446
EMBLU73191 | D87291 | Y10745 | BC013327
InterProIPR016449 | IPR001838 | IPR003270 | IPR013521 | IPR013518
PRODOMPD001103
GENEID3772
MIM602106
PRINTSPR01323 | PR01320
PFAMPF01007
Details:
Details
NameATP-sensitive inward rectifier potassium channel 15-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 15;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 15;AltName: Full=Inward rectifier K(+) channel Kir4.2;AltName: Full=Kir1.3;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ15 | KCNJ1
FunctionInward rectifier potassium channels are characterized bys a greater tendency to allow potassium to flow into the cell rathers than out of it
Fragment0
Sequence
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
2Ggamma-3_Homo sapiensStimulation15251227 | 10990455
3Ggamma-13_Homo sapiensStimulation15251227 | 10990455
4Ggamma-8_Homo sapiensStimulation15251227 | 10990455
5Gbeta-3_Homo sapiensStimulation15251227 | 10990455
6Gbeta-5_Homo sapiensStimulation15251227 | 10990455
7Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
8Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
9Gbeta-4_Homo sapiensStimulation15251227 | 10990455
10Ggamma-4_Homo sapiensStimulation15251227 | 10990455
11Ggamma-2_Homo sapiensStimulation15251227 | 10990455
12Ggamma-12_Homo sapiensStimulation15251227 | 10990455
13Ggamma-11_Homo sapiensStimulation15251227 | 10990455
14Gbeta-1_Homo sapiensStimulation15251227 | 10990455
15Ggamma-5_Homo sapiensStimulation15251227 | 10990455
16Ggamma-10_Homo sapiensStimulation15251227 | 10990455
17Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
18Ggamma-7_Homo sapiensStimulation15251227 | 10990455
19Gbeta-2_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level