Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 1-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 1
Cross References:
References
UniProtP48048 | Q6LD67
EMBLU12541 | U12542 | U12543 | U12544 | U12545 | U03884 | U65406 | U65406 | U65406 | BC074752 | S78737
InterProIPR016449 | IPR001838 | IPR003268 | IPR013521 | IPR013518
PRODOMPD001103
GENEID3758
MIM241200 | 600359
PRINTSPR01321 | PR01320
PFAMPF01007
Details:
Details
NameATP-sensitive inward rectifier potassium channel 1-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 1;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 1;AltName: Full=ATP-regulated potassium channel ROM-K;AltName: Full=Kir1.1;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ1 | ROMK
FunctionIn the kidney, probably plays a major role in potassiums homeostasis
Fragment0
Sequence
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-5_Homo sapiensStimulation15251227 | 10990455
2Gbeta-4_Homo sapiensStimulation15251227 | 10990455
3Ggamma-12_Homo sapiensStimulation15251227 | 10990455
4Gbeta-1_Homo sapiensStimulation15251227 | 10990455
5Ggamma-4_Homo sapiensStimulation15251227 | 10990455
6Ggamma-10_Homo sapiensStimulation15251227 | 10990455
7Ggamma-2_Homo sapiensStimulation15251227 | 10990455
8Gbeta-2_Homo sapiensStimulation15251227 | 10990455
9Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
10Ggamma-13_Homo sapiensStimulation15251227 | 10990455
11Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
12Gbeta-3_Homo sapiensStimulation15251227 | 10990455
13Ggamma-11_Homo sapiensStimulation15251227 | 10990455
14Ggamma-8_Homo sapiensStimulation15251227 | 10990455
15Ggamma-7_Homo sapiensStimulation15251227 | 10990455
16Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
17Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
18Ggamma-3_Homo sapiensStimulation15251227 | 10990455
19Gbeta-5_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level