Quick search:







Description Entry page for Effector - 'ATP-sensitive inward rectifier potassium channel 8-Homo sapiens'
FamilyIon channels
Sub-FamilyATP-sensitive inward rectifier potassium channels
TypeATP-sensitive inward rectifier potassium channel 8
Cross References:
References
UniProtQ15842 | O00657
EMBLD50312 | D50315 | BC000544
InterProIPR016449 | IPR001838 | IPR003278 | IPR013521 | IPR013518
PRODOMPD001103
GENEID3764
MIM600935
PRINTSPR01331 | PR01320
PFAMPF01007
Details:
Details
NameATP-sensitive inward rectifier potassium channel 8-Homo sapiens
Description"RecName: Full=ATP-sensitive inward rectifier potassium channel 8;AltName: Full=Potassium channel, inwardly rectifying subfamily J member 8;AltName: Full=Inwardly rectifier K(+) channel Kir6.1;AltName: Full=uKATP-1;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKCNJ
FunctionThis potassium channel is controlled by G proteins
Fragment0
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-8_Homo sapiensStimulation15251227 | 10990455
2Ggamma-5_Homo sapiensStimulation15251227 | 10990455
3Gbeta-5_Homo sapiensStimulation15251227 | 10990455
4Gbeta-like_Homo sapiens_1Stimulation15251227 | 10990455
5Gbeta-2_Homo sapiensStimulation15251227 | 10990455
6Gbeta-4_Homo sapiensStimulation15251227 | 10990455
7Ggamma-10_Homo sapiensStimulation15251227 | 10990455
8Gbeta-3_Homo sapiensStimulation15251227 | 10990455
9Ggamma-11_Homo sapiensStimulation15251227 | 10990455
10Ggamma-2_Homo sapiensStimulation15251227 | 10990455
11Ggamma-3_Homo sapiensStimulation15251227 | 10990455
12Gbeta-like_Homo sapiens_2Stimulation15251227 | 10990455
13Ggamma-13_Homo sapiensStimulation15251227 | 10990455
14Ggamma-4_Homo sapiensStimulation15251227 | 10990455
15Ggamma-12_Homo sapiensStimulation15251227 | 10990455
16Gbeta-1_Homo sapiensStimulation15251227 | 10990455
17Ggamma-t1_Homo sapiensStimulation15251227 | 10990455
18Ggamma-7_Homo sapiensStimulation15251227 | 10990455
19Ggamma-t2_Homo sapiensStimulation15251227 | 10990455
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level