Quick search:







Description Entry page for Effector - 'Brutons tyrosine kinase-Homo sapiens'
FamilyTyr protein kinases
Sub-FamilyTyr protein kinases
TypeBrutons tyrosine kinase
Cross References:
References
UniProtQ06187 | Q32ML5
EMBLX58957 | U10087 | U10084 | U10085 | U10086 | L31572 | L31557 | L31558 | L31559 | L31561 | L31563 | L31564 | L31565 | L31566 | L31567 | L31568 | L31569 | L31570 | L31571 | U13433 | U13410 | U13412 | U13413 | U13414 | U13415 | U13416 | U13417 | U13422 | U13423 | U13424 | U13425 | U13427 | U13428 | U13429 | U13430 | U13431 | U13432 | U78027 | AL035422 | BC109079 | BC109080
InterProIPR011993 | IPR001849 | IPR000719 | IPR017441 | IPR000980 | IPR001452 | IPR020473 | IPR001245 | IPR008266 | IPR001562
PRODOMPD000001 | PD000093 | PD000066
GENEID695
MIM300300 | 300755 | 307200
PRINTSPR00401 | PR00452 | PR00402 | PR00109
PFAMPF00779 | PF00169 | PF07714 | PF00017 | PF00018
Details:
Details
NameBrutons tyrosine kinase-Homo sapiens
DescriptionRecName: Full=Tyrosine-protein kinase BTK; EC=2.7.10.2;AltName: Full=Bruton tyrosine kinase;AltName: Full=Agammaglobulinaemia tyrosine kinase; Short=ATK;AltName: Full=B-cell progenitor kinase; Short=BPK
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneBTK | AGMX1,ATK,BP
FunctionPlays a crucial role in B-cell ontogeny
Fragment0
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-8_Homo sapiensStimulation15251227 | 11698416
2Ggamma-t1_Homo sapiensStimulation15251227 | 11698416
3Ggamma-5_Homo sapiensStimulation15251227 | 11698416
4Ggamma-10_Homo sapiensStimulation15251227 | 11698416
5Gbeta-5_Homo sapiensStimulation15251227 | 11698416
6Ggamma-4_Homo sapiensStimulation15251227 | 11698416
7Ggamma-12_Homo sapiensStimulation15251227 | 11698416
8Ggamma-3_Homo sapiensStimulation15251227 | 11698416
9Gbeta-like_Homo sapiens_2Stimulation15251227 | 11698416
10Galpha-q_Homo sapiensStimulation (indirect stimulation of p38 MAPK)15251227 | 9305846 | 16182515
11Ggamma-7_Homo sapiensStimulation15251227 | 11698416
12Ggamma-t2_Homo sapiensStimulation15251227 | 11698416
13Gbeta-3_Homo sapiensStimulation15251227 | 11698416
14Gbeta-like_Homo sapiens_1Stimulation15251227 | 11698416
15Gbeta-1_Homo sapiensStimulation15251227 | 11698416
16Ggamma-11_Homo sapiensStimulation15251227 | 11698416
17Ggamma-2_Homo sapiensStimulation15251227 | 11698416
18Ggamma-13_Homo sapiensStimulation15251227 | 11698416
19Gbeta-2_Homo sapiensStimulation15251227 | 11698416
20Gbeta-4_Homo sapiensStimulation15251227 | 11698416
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level