Quick search:







Description Entry page for Effector - 'Cdc42-Homo sapiens'
FamilySmall GTP-binding proteins
Sub-FamilyRho small GTPases
TypeCdc42
Cross References:
References
UniProtP60953 | P21181 | P25763 | Q7L8R5
EMBLM35543 | M57298 | AL121734 | AL121735 | AF498962 | AF498963 | AY673602 | AL031281 | AL031281 | BC002711 | BC003682 | BC018266
InterProIPR003578 | IPR013753 | IPR001806 | IPR005225
PRODOM
GENEID998
MIM116952
PRINTSPR00449
PFAMPF00071
Details:
Details
NameCdc42-Homo sapiens
DescriptionRecName: Full=Cell division control protein 42 homolog;AltName: Full=G25K GTP-binding protein;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCDC4
FunctionPlasma membrane-associated small GTPase which cycless between an active GTP-bound and an inactive GDP-bound state
Fragment0
Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP
ETQPKRKCCIF
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-5_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
2Gbeta-like_Homo sapiens_2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
3Ggamma-t2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Ggamma-7_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
5Ggamma-11_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
6Ggamma-4_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
7Gbeta-2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
8Gbeta-like_Homo sapiens_1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
9Ggamma-2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
10Ggamma-t1_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
11Gbeta-4_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
12Ggamma-10_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
13Galpha-i1_Homo sapiensStimulation11099498
14Ggamma-13_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
15Gbeta-3_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Galpha-i3_Homo sapiensStimulation11099498
17Ggamma-12_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
18Galpha-i2_Homo sapiensStimulation11099498
19Ggamma-3_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
20Ggamma-8_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
21Ggamma-5_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
22Gbeta-1_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level