Quick search:







Description Entry page for Effector - 'Adenylate cyclase 2-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 2
Cross References:
References
UniProtQ08462 | Q2NKL8 | Q9UPU2
EMBLAF410885 | BC111743 | AB028983 | X74210 | L21993
InterProIPR001054 | IPR018297 | IPR009398
PRODOM
GENEID108
MIM103071
PRINTS
PFAMPF06327 | PF00211
Details:
Details
NameAdenylate cyclase 2-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 2; EC=4.6.1.1;AltName: Full=Adenylate cyclase type II;AltName: Full=ATP pyrophosphate-lyase 2;AltName: Full=Adenylyl cyclase 2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY2 | KIAA106
FunctionThis is a membrane-bound, calmodulin-insensitives adenylyl cyclase
Fragment0
Sequence
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-4_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2Ggamma-3_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
3Ggamma-11_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
4Gbeta-2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5Ggamma-5_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
6Gbeta-4_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
7Ggamma-t2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
8Ggamma-10_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
9Ggamma-12_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
10Ggamma-t1_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11Ggamma-7_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
12Gbeta-like_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
13Gbeta-1_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
14Ggamma-8_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
15Gbeta-like_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
16Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
17Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
18Gbeta-3_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
19Gbeta-5_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
20Ggamma-13_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
21Ggamma-2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level