Quick search:







Description Entry page for Effector - 'Dynamin 1-Homo sapiens'
FamilyDynamins
Sub-FamilyDynamins
TypeDynamin 1
Cross References:
References
UniProtQ05193 | A6NLM6 | Q5SYX0 | Q5SYX2 | Q6P3T6 | Q86VD2
EMBLL07807 | L07808 | L07809 | L07810 | AL590708 | AL590708 | BC050279 | BC063850
InterProIPR000375 | IPR001401 | IPR019762 | IPR003130 | IPR011993 | IPR001849
PRODOM
GENEID1759
MIM602377
PRINTSPR00195
PFAMPF01031 | PF00350 | PF02212 | PF00169
Details:
Details
NameDynamin 1-Homo sapiens
DescriptionRecName: Full=Dynamin-1; EC=3.6.5.5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneDNM1 | DN
FunctionMicrotubule-associated force-producing protein involveds in producing microtubule bundles and able to bind and hydrolyzes GTP
Fragment0
Sequence
MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPI
NLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSD
LANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQK
DIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKL
QSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGA
RINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKI
REPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLID
IELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKE
YWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDY
RQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVE
TIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAE
QAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPT
PQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAP
PGVPSRSGQASPSRPESPRPPFDL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-like_Homo sapiens_2Increased GTPase activity15251227 | 14671004
2Ggamma-10_Homo sapiensIncreased GTPase activity15251227 | 14671004
3Ggamma-12_Homo sapiensIncreased GTPase activity15251227 | 14671004
4Gbeta-2_Homo sapiensIncreased GTPase activity15251227 | 14671004
5Gbeta-1_Homo sapiensIncreased GTPase activity15251227 | 14671004
6Ggamma-8_Homo sapiensIncreased GTPase activity15251227 | 14671004
7Ggamma-5_Homo sapiensIncreased GTPase activity15251227 | 14671004
8Ggamma-13_Homo sapiensIncreased GTPase activity15251227 | 14671004
9Ggamma-2_Homo sapiensIncreased GTPase activity15251227 | 14671004
10Ggamma-t2_Homo sapiensIncreased GTPase activity15251227 | 14671004
11Gbeta-5_Homo sapiensIncreased GTPase activity15251227 | 14671004
12Ggamma-7_Homo sapiensIncreased GTPase activity15251227 | 14671004
13Ggamma-4_Homo sapiensIncreased GTPase activity15251227 | 14671004
14Gbeta-4_Homo sapiensIncreased GTPase activity15251227 | 14671004
15Gbeta-like_Homo sapiens_1Increased GTPase activity15251227 | 14671004
16Ggamma-3_Homo sapiensIncreased GTPase activity15251227 | 14671004
17Gbeta-3_Homo sapiensIncreased GTPase activity15251227 | 14671004
18Ggamma-t1_Homo sapiensIncreased GTPase activity15251227 | 14671004
19Ggamma-11_Homo sapiensIncreased GTPase activity15251227 | 14671004
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level