Quick search:







Description Entry page for Effector - 'E cadherin-Homo sapiens'
FamilyCadherins
Sub-FamilyCadherins
TypeE cadherin
Cross References:
References
UniProtP12830 | Q13799 | Q14216 | Q15855 | Q16194 | Q4PJ14
EMBLZ13009 | Z18923 | L08599 | DQ090940 | L34545 | D49685 | Z35402 | Z35403 | Z35404 | Z35405 | Z35406 | Z35407 | Z35408 | Z35409 | Z35410 | Z35411 | Z35412 | Z35413 | Z35414 | Z35415 | X12790 | X52279 | S72492 | S72397 | S72491
InterProIPR002126 | IPR000233 | IPR014868
PRODOM
GENEID999
MIM137215 | 167000 | 192090 | 608089
PRINTSPR00205
PFAMPF00028 | PF01049 | PF08758
Details:
Details
NameE cadherin-Homo sapiens
DescriptionRecName: Full=Cadherin-1;AltName: Full=Epithelial cadherin; Short=E-cadherin;AltName: Full=Uvomorulin;AltName: Full=CAM 120/80;AltName: CD_antigen=CD324;Contains: RecName: Full=E-Cad/CTF1;Contains: RecName: Full=E-Cad/CTF2;Contains: RecName: Full=E-Cad/CTF3;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCDH1 | CDHE,UV
FunctionCadherins are calcium-dependent cell adhesion proteins
Fragment0
Sequence
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-12_Homo sapiensStimulation (stimulation of h-catenin release)15251227 | 14607242 | 11136230
2Galpha-13_Homo sapiensStimulation (stimulation of h-catenin release)15251227 | 14607242 | 11136230
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level