Quick search:







Description Entry page for Effector - 'G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiens'
FamilyG-protein-regulated inducers of neurite outgrowth
Sub-FamilyG-protein-regulated inducers of neurite outgrowth
TypeG-protein-regulated inducer of neurite outgrowth GRIN1
Cross References:
References
UniProtQ7Z2K8 | Q8ND74 | Q96PZ4
EMBLAB067480 | BC052950 | AL834165
InterPro
PRODOM
GENEID
MIM611239
PRINTS
PFAM
Details:
Details
NameG-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiens
DescriptionRecName: Full=G protein-regulated inducer of neurite outgrowth 1; Short=GRIN1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPRIN1 | KIAA189
FunctionMay be involved in neurite outgrowth (By similarity)
Fragment0
Sequence
MDTAEDPAWLQLLQKDSSPPGPRPTAFFCPQDGSLGAGSSAMRDYCPSQQKASPAPPRHT
PDQSPGMESRHRSPSGAGEGASCSDGPRGSLACPSPTCFSPQESPSKETLEAHGASISGT
TEATTSGKPEPVSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKADPM
FTGKAEPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRK
VDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPTSAEKVDLVLSGKRDPGPSGKADPV
PLESMDSASTGKTEPGLLGKLIPGSSGKNGPVSSGTGAPGSLGRLDPTCLGMADPASVGN
VETVPATKEDSRFLGKMDPASSGEGRPVSGHTDTTASAKTDLTSLKNVDPMSSGKVDPVS
LGKMDPMCSGKPELLSPGQAERVSVGKAGTVSPGKEDPVSSRREDPISAGSRKTSSEKVN
PESSGKTNPVSSGPGDPRSLGTAGPPSAVKAEPATGGKGDPLSSEKAGLVASGKAAPTAS
GKAEPLAVGKEDPVSKGKADAGPSGQGDSVSIGKVVSTPGKTVPVPSGKVDPVSLGKAEA
IPEGKVGSLPLEKGSPVTTTKADPRASGKAQPQSGGKAETKLPGQEGAAAPGEAGAVCLK
KETPQASEKVDPGSCRKAEPLASGKGEPVSLGKADSAPSRKTESPSLGKVVPLSLEKTKP
SSSSRQLDRKALGSARSPEGARGSEGRVEPKAEPVSSTEASSLGQKDLEAAGAERSPCPE
AAAPPPGPRTRDNFTKAPSWEASAPPPPREDAGTQAGAQACVSVAVSPMSPQDGAGGSAF
SFQAAPRAPSPPSRRDAGLQVSLGAAETRSVATGPMTPQAAAPPAFPEVRVRPGSALAAA
VAPPEPAEPVRDVSWDEKGMTWEVYGAAMEVEVLGMAIQKHLERQIEEHGRQGAPAPPPA
ARAGPGRSGSVRTAPPDGAAKRPPGLFRALLQSVRRPRCCSRAGPTAE
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i2_Homo sapiensUnknown15251227 | 10480904 | 14671004
2Galpha-i1_Homo sapiensUnknown15251227 | 10480904 | 14671004
3Galpha-i3_Homo sapiensUnknown15251227 | 10480904 | 14671004
4Galpha-o_Homo sapiensUnknown15251227 | 10480904 | 14671004
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level