Quick search:







Description Entry page for Effector - 'G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiens'
FamilyG-protein-regulated inducers of neurite outgrowth
Sub-FamilyG-protein-regulated inducers of neurite outgrowth
TypeG-protein-regulated inducer of neurite outgrowth GRIN2
Cross References:
References
UniProtO60269 | Q5SVF0
EMBLAB011086 | AL645529 | BC011672
InterPro
PRODOM
GENEID9721
MIM611240
PRINTS
PFAM
Details:
Details
NameG-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiens
DescriptionRecName: Full=G protein-regulated inducer of neurite outgrowth 2; Short=GRIN2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGPRIN2 | KIAA051
FunctionMay be involved in neurite outgrowth
Fragment0
Sequence
MSSSRPEPGPWAPLSPRLQPLSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQ
APEEEGNPPESMKPARASGPKARPSAGGHWWSSTVGNVSTMGGSDLCRLRAPSAAAMQRS
HSDLVRSTQMRGHSGARKASLSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLAPED
ETSNSAWMLGASQLSVPPLDLGDTTAHSSSAQAEPKAAEQLATTTCHALPPAALLCGMRE
VRAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHCRLSGGLPGHSHCCAHLWGPA
GLVPEPGSRTKDVWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKAVATSPSLEAPAAL
HVFPEVTLGSSLEEVPSPVRDVRWDAEGMTWEVYGAAVDLEVLGVAIQKHLEMQFEQLQR
APASEDSLSVEGRRGPLRAVMQSLRRPSCCGCSGAAPE
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-o_Homo sapiensUnknown15251227 | 10480904 | 14671004
2Galpha-i3_Homo sapiensUnknown15251227 | 10480904 | 14671004
3Galpha-i1_Homo sapiensUnknown15251227 | 10480904 | 14671004
4Galpha-i2_Homo sapiensUnknown15251227 | 10480904 | 14671004
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level