Quick search:







Description Entry page for Effector - 'GRK2-Homo sapiens'
FamilySer Thr protein kinases
Sub-FamilyG protein coupled receptor kinases
TypeGRK2
Cross References:
References
UniProtP25098 | B0ZBE1 | Q13837 | Q6GTT3
EMBLX61157 | M80776 | U08438 | U08435 | U08436 | U08437 | EU326303 | BC037963 | BC090863
InterProIPR000961 | IPR015743 | IPR000239 | IPR011993 | IPR001849 | IPR000719 | IPR017441 | IPR000342 | IPR017442 | IPR008271 | IPR002290
PRODOMPD000001 | PD001580
GENEID156
MIM109635
PRINTSPR00717
PFAMPF00169 | PF00069 | PF00615
Details:
Details
NameGRK2-Homo sapiens
DescriptionRecName: Full=Beta-adrenergic receptor kinase 1; Short=Beta-ARK-1; EC=2.7.11.15;AltName: Full=G-protein coupled receptor kinase 2
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRBK1 | BARK,BARK1,GRK
FunctionSpecifically phosphorylates the agonist-occupied form ofs the beta-adrenergic and closely related receptors, probablys inducing a desensitization of them
Fragment0
Sequence
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-11_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
2Ggamma-12_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
3Gbeta-5_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
4Galpha-14_Homo sapiensInhibits PLC-beta activation and blocks Gqa-mediated GLUT4 translocation and glucose uptake in 3T3 adipocytes15251227 | 14654303 | 16182515
5Galpha-11_Homo sapiensInhibits PLC-beta activation and blocks Gqa-mediated GLUT4 translocation and glucose uptake in 3T3 adipocytes15251227 | 14654303 | 16182515
6Ggamma-2_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
7Gbeta-3_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
8Ggamma-3_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
9Ggamma-8_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
10Ggamma-4_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
11Ggamma-7_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
12Gbeta-2_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
13Galpha-q_Homo sapiensInhibits PLC-beta activation and blocks Gqa-mediated GLUT4 translocation and glucose uptake in 3T3 adipocytes15251227 | 14654303 | 16182515
14Gbeta-like_Homo sapiens_1Recruitment to plasma membrane15251227 | 14654303
15Ggamma-10_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
16Ggamma-5_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
17Ggamma-13_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
18Ggamma-t2_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
19Gbeta-like_Homo sapiens_2Recruitment to plasma membrane15251227 | 14654303
20Gbeta-1_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
21Gbeta-4_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
22Ggamma-t1_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level