Quick search:







Description Entry page for Effector - 'GRK3-Homo sapiens'
FamilySer Thr protein kinases
Sub-FamilyG protein coupled receptor kinases
TypeGRK3
Cross References:
References
UniProtP35626 | Q9UGW9
EMBLX69117 | AL022329
InterProIPR000961 | IPR015743 | IPR000239 | IPR011993 | IPR001849 | IPR000719 | IPR017441 | IPR000342 | IPR017442 | IPR008271 | IPR002290
PRODOMPD000001
GENEID157
MIM109636
PRINTSPR00717
PFAMPF00169 | PF00069 | PF00615
Details:
Details
NameGRK3-Homo sapiens
DescriptionRecName: Full=Beta-adrenergic receptor kinase 2; Short=Beta-ARK-2; EC=2.7.11.15;AltName: Full=G-protein-coupled receptor kinase 3
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADRBK2 | BARK2,GRK
FunctionSpecifically phosphorylates the agonist-occupied form ofs the beta-adrenergic and closely related receptors
Fragment0
Sequence
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRR
APKFLNKPRSGTVELPKPSLCHRNSNGL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-like_Homo sapiens_1Recruitment to plasma membrane15251227 | 14654303
2Gbeta-1_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
3Gbeta-5_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
4Galpha-11_Homo sapiensStimulation15251227 | 14654303 | 16182515
5Ggamma-10_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
6Galpha-q_Homo sapiensStimulation15251227 | 14654303 | 16182515
7Ggamma-t1_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
8Ggamma-12_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
9Ggamma-t2_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
10Gbeta-2_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
11Ggamma-2_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
12Gbeta-like_Homo sapiens_2Recruitment to plasma membrane15251227 | 14654303
13Gbeta-4_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
14Ggamma-4_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
15Ggamma-8_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
16Gbeta-3_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
17Ggamma-3_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
18Ggamma-11_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
19Ggamma-13_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
20Ggamma-5_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
21Ggamma-7_Homo sapiensRecruitment to plasma membrane15251227 | 14654303
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level