Quick search:







Description Entry page for Effector - 'Kinase suppressor of Ras(KSR)-Homo sapiens'
FamilySer Thr protein kinases
Sub-FamilyKinase suppressor of Ras(KSR)
TypeKinase suppressor of Ras(KSR)
Cross References:
References
UniProtQ8IVT5 | Q13476
EMBLAC069366 | AC015688 | BC042106 | U43586
InterProIPR002219 | IPR000719 | IPR008271 | IPR001245
PRODOMPD000001
GENEID8844
MIM601132
PRINTS
PFAMPF00130 | PF07714
Details:
Details
NameKinase suppressor of Ras(KSR)-Homo sapiens
DescriptionRecName: Full=Kinase suppressor of Ras 1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneKSR1 | KS
FunctionLocation-regulated scaffolding protein connecting MEK tos RAF
Fragment0
Sequence
MDRAALRAAAMGEKKEGGGGGDAAEGGAGAAASRALQQCGQLQKLIDISIGSLRGLRTKC
AVSNDLTQQEIRTLEAKLVRYICKQRQCKLSVAPGERTPELNSYPRFSDWLYTFNVRPEV
VQEIPRDLTLDALLEMNEAKVKETLRRCGASGDECGRLQYALTCLRKVTGLGGEHKEDSS
WSSLDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPS
FSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPS
FPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMVRRDIGLSVTHRFSTKSWLSQVCHV
CQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPH
FGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQR
DSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADG
TRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVY
LQEWDIPFEQVELGEPIGQGRWGRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYR
QTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVRDPKTSLDINKTRQIAQEIIKGMG
YLHAKGIVHKDLKSKNVFYDNGKVVITDFGLFGISGVVREGRRENQLKLSHDWLCYLAPE
IVREMTPGKDEDQLPFSKAADVYAFGTVWYELQARDWPLKNQAAEASIWQIGSGEGMKRV
LTSVSLGKEVSEILSACWAFDLQERPSFSLLMDMLEKLPKLNRRLSHPGHFWKSAEINSS
KVVPRFERFGLGVLESSNPKM
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-4_Homo sapiensSequestration of Gbeta/gamma15251227
2Ggamma-12_Homo sapiensSequestration of Gbeta/gamma15251227
3Gbeta-like_Homo sapiens_1Sequestration of Gbeta/gamma15251227
4Gbeta-like_Homo sapiens_2Sequestration of Gbeta/gamma15251227
5Gbeta-5_Homo sapiensSequestration of Gbeta/gamma15251227
6Ggamma-4_Homo sapiensSequestration of Gbeta/gamma15251227
7Ggamma-3_Homo sapiensSequestration of Gbeta/gamma15251227
8Gbeta-1_Homo sapiensSequestration of Gbeta/gamma15251227
9Ggamma-5_Homo sapiensSequestration of Gbeta/gamma15251227
10Ggamma-t2_Homo sapiensSequestration of Gbeta/gamma15251227
11Ggamma-10_Homo sapiensSequestration of Gbeta/gamma15251227
12Ggamma-t1_Homo sapiensSequestration of Gbeta/gamma15251227
13Ggamma-11_Homo sapiensSequestration of Gbeta/gamma15251227
14Ggamma-13_Homo sapiensSequestration of Gbeta/gamma15251227
15Ggamma-7_Homo sapiensSequestration of Gbeta/gamma15251227
16Ggamma-8_Homo sapiensSequestration of Gbeta/gamma15251227
17Gbeta-2_Homo sapiensSequestration of Gbeta/gamma15251227
18Ggamma-2_Homo sapiensSequestration of Gbeta/gamma15251227
19Gbeta-3_Homo sapiensSequestration of Gbeta/gamma15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level