Quick search:







Description Entry page for Effector - 'LARG RhoGEF-Homo sapiens'
FamilyGuanine nucleotide exchange factors
Sub-FamilyRhoGEFs
TypeLARG RhoGEF
Cross References:
References
UniProtQ9NZN5 | O15086 | Q6P526
EMBLAF180681 | AB002380 | BC063117
InterProIPR000219 | IPR001331 | IPR001478 | IPR011993 | IPR001849 | IPR015212 | IPR015721
PRODOM
GENEID23365
MIM604763
PRINTS
PFAMPF00595 | PF09128 | PF00621
Details:
Details
NameLARG RhoGEF-Homo sapiens
DescriptionRecName: Full=Rho guanine nucleotide exchange factor 12;AltName: Full=Leukemia-associated RhoGEF
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneARHGEF12 | KIAA0382,LAR
FunctionMay play a role in the regulation of RhoA GTPase bys guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13)
Fragment0
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDAS
RPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGY
LPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTG
DIATCYSPRTSTESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-12_Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 12024019 | 14607242
2Galpha-q_Homo sapiensStimulation (indirect activation of Rho)15251227 | 12024019
3Galpha-13_Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 12024019 | 14607242
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level