Quick search:







Description Entry page for Effector - 'p115 RhoGEF-Homo sapiens'
FamilyGuanine nucleotide exchange factors
Sub-FamilyRhoGEFs
Typep115 RhoGEF
Cross References:
References
UniProtQ92888 | O00513 | Q8N4J4 | Q96BF4 | Q96F17 | Q9BSB1
EMBLU64105 | BC005155 | BC011726 | BC015652 | BC034013 | Y09160 | BT007421
InterProIPR000219 | IPR001331 | IPR011993 | IPR001849 | IPR015212 | IPR015721
PRODOM
GENEID9138
MIM601855
PRINTS
PFAMPF09128 | PF00621
Details:
Details
Namep115 RhoGEF-Homo sapiens
DescriptionRecName: Full=Rho guanine nucleotide exchange factor 1;AltName: Full=115 kDa guanine nucleotide exchange factor;AltName: Full=p115-RhoGEF;AltName: Full=p115RhoGEF;AltName: Full=Sub1.5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneARHGEF
FunctionSeems to play a role in the regulation of RhoA GTPase bys guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13)s subunits
Fragment0
Sequence
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ
LGGNSVPQPGCT
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-12_Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 14607242
2Galpha-q_Homo sapiensNo data1525227 | 16182515
3Galpha-13_Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 14607242
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level