Quick search:







Description Entry page for Effector - 'PDZ RhoGEF-Homo sapiens'
FamilyGuanine nucleotide exchange factors
Sub-FamilyRhoGEFs
TypePDZ RhoGEF
Cross References:
References
UniProtO15085 | Q5VY40
EMBLAB002378 | AL356104 | AL157713 | AL157713 | AL356104
InterProIPR000219 | IPR001331 | IPR001478 | IPR011993 | IPR001849 | IPR000342 | IPR015212 | IPR015721
PRODOM
GENEID9826
MIM605708
PRINTS
PFAMPF00595 | PF09128 | PF00621
Details:
Details
NamePDZ RhoGEF-Homo sapiens
DescriptionRecName: Full=Rho guanine nucleotide exchange factor 11;AltName: Full=PDZ-RhoGEF
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneARHGEF11 | KIAA038
FunctionMay play a role in the regulation of RhoA GTPase bys guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13)
Fragment0
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQ
GKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
EGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAP
MSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPC
PEDGSDAPLEDSTADAAASPGP
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-13_Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 11799111 | 14607242
2Galpha-12_Homo sapiensStimulation (indirect activation of Rho and stress fiber formation)15251227 | 11799111 | 14607242
3Galpha-q_Homo sapiensNo data1525227 | 16182515
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level