Quick search:







Description Entry page for Effector - 'Phosphodiesterase 6-Homo sapiens-1'
FamilyPhosphodiesterases
Sub-FamilyRhodopsin-sensitive cGMP-specific PDEases
TypePhosphodiesterase 6
Cross References:
References
UniProtP16499 | Q0P638
EMBLM26061 | CH471062 | BC035909
InterProIPR003018 | IPR003607 | IPR002073
PRODOM
GENEID5145
MIM180071 | 268000
PRINTSPR00387
PFAMPF01590 | PF00233
Details:
Details
NamePhosphodiesterase 6-Homo sapiens-1
Description"RecName: Full=Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha; Short=GMP-PDE alpha; EC=3.1.4.35;AltName: Full=PDE V-B1;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePDE6A | PDE
FunctionThis protein participates in processes of transmissions and amplification of the visual signal
Fragment0
Sequence
MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEI
IFDLLRDFQENLQTEKCIFNVMKKLCFLLQADRMSLFMYRTRNGIAELATRLFNVHKDAV
LEDCLVMPDQEIVFPLDMGIVGHVAHSKKIANVPNTEEDEHFCDFVDILTEYKTKNILAS
PIMNGKDVVAIIMAVNKVDGSHFTKRDEEILLKYLNFANLIMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPAYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKMKVQEEKKQKQQSAKSAAAGN
QPGGNPSPGGATTSKSCCIQ
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-t1_Homo sapiensStimulation15251227 | 15988071 | 14699118
2Galpha-t3_Homo sapiensStimulation15251227 | 15988071 | 14699118
3Galpha-t2_Homo sapiensStimulation15251227 | 15988071 | 14699118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level