Quick search:







Description Entry page for Effector - 'Phosphodiesterase 6-Homo sapiens-2'
FamilyPhosphodiesterases
Sub-FamilyRhodopsin-sensitive cGMP-specific PDEases
TypePhosphodiesterase 6
Cross References:
References
UniProtP35913 | Q53XN5 | Q9BWH5 | Q9UD49
EMBLX62692 | X62693 | X62694 | X62695 | X66142 | S41458 | BT009794 | AC107464 | BC000249 | X90587 | X90588 | X90589 | X90590
InterProIPR003018 | IPR003607 | IPR002073
PRODOM
GENEID5158
MIM163500 | 180072 | 268000
PRINTSPR00387
PFAMPF01590 | PF00233
Details:
Details
NamePhosphodiesterase 6-Homo sapiens-2
Description"RecName: Full=Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta; Short=GMP-PDE beta; EC=3.1.4.35;Flags: Precursor;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePDE6B | PDE
FunctionThis protein participates in processes of transmissions and amplification of the visual signal
Fragment0
Sequence
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPPDCDSLRDLCQVEESTALL
ELVQDMQESINMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVEDVAECPHFSSFADELTDYKTKNMLATPI
MNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPY
SGPRTPDGREIVFYKVIDYVLHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNA
SADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPADC
DEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRAMFQKIVDESKNYQDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEKEEEERVAAKKVGTEIC
NGGPAPKSSTCCIL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-t2_Homo sapiensStimulation15251227 | 15988071 | 14699118
2Galpha-t1_Homo sapiensStimulation15251227 | 15988071 | 14699118
3Galpha-t3_Homo sapiensStimulation15251227 | 15988071 | 14699118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level