Quick search:







Description Entry page for Effector - 'Phosphodiesterase 6-Homo sapiens-3'
FamilyPhosphodiesterases
Sub-FamilyRhodopsin-sensitive cGMP-specific PDEases
TypePhosphodiesterase 6
Cross References:
References
UniProtO43924 | O43250
EMBLAF045999 | AF022912 | AF042835 | AF042833 | AF042834 | AJ001626 | BT007278 | BC007831
InterProIPR008015 | IPR017287
PRODOM
GENEID5147
MIM602676
PRINTS
PFAMPF05351
Details:
Details
NamePhosphodiesterase 6-Homo sapiens-3
Description"RecName: Full=Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta; Short=GMP-PDE delta;AltName: Full=Protein p17;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePDE6D | PDE
Function
Fragment0
Sequence
MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-t3_Homo sapiensStimulation15251227 | 15988071 | 14699118
2Galpha-t2_Homo sapiensStimulation15251227 | 15988071 | 14699118
3Galpha-t1_Homo sapiensStimulation15251227 | 15988071 | 14699118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level