Quick search:







Description Entry page for Effector - 'Adenylate cyclase 4-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 4
Cross References:
References
UniProtQ8NFM4 | Q17R40 | Q96ML7
EMBLAF497516 | BC117473 | BC117475 | AK056745
InterProIPR001054 | IPR018297 | IPR009398
PRODOM
GENEID196883
MIM600292
PRINTS
PFAMPF06327 | PF00211
Details:
Details
NameAdenylate cyclase 4-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 4; EC=4.6.1.1;AltName: Full=Adenylate cyclase type IV;AltName: Full=ATP pyrophosphate-lyase 4;AltName: Full=Adenylyl cyclase 4
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY
FunctionThis is a membrane-bound, calmodulin-insensitives adenylyl cyclase (By similarity)
Fragment0
Sequence
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-10_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
2Ggamma-12_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
3Ggamma-13_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
4Gbeta-5_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
5Gbeta-3_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
6Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
7Ggamma-2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
8Ggamma-5_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
9Ggamma-4_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
10Ggamma-3_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
11Gbeta-2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
12Ggamma-t1_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
13Ggamma-t2_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
14Ggamma-7_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
15Gbeta-1_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
16Ggamma-8_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
17Ggamma-11_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
18Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
19Gbeta-like_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
20Gbeta-like_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
21Gbeta-4_Homo sapiensStimulation15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level