Quick search:







Description Entry page for Effector - 'Phosphodiesterase 6-Homo sapiens-4'
FamilyPhosphodiesterases
Sub-FamilyRhodopsin-sensitive cGMP-specific PDEases
TypePhosphodiesterase 6
Cross References:
References
UniProtP18545 | Q3KP63
EMBLM36476 | X62025 | U00482 | U00481 | BC106884
InterProIPR006952
PRODOM
GENEID5148
MIM180073
PRINTS
PFAMPF04868
Details:
Details
NamePhosphodiesterase 6-Homo sapiens-4
Description"RecName: Full=Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma; Short=GMP-PDE gamma; EC=3.1.4.17;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePDE6G | PDE
FunctionParticipates in processes of transmission ands amplification of the visual signal
Fragment0
Sequence
MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGL
GTDITVICPWEAFNHLELHELAQYGII
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-t2_Homo sapiensStimulation15251227 | 15988071 | 14699118
2Galpha-t1_Homo sapiensStimulation15251227 | 15988071 | 14699118
3Galpha-t3_Homo sapiensStimulation15251227 | 15988071 | 14699118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level