Quick search:







Description Entry page for Effector - 'Phospholipase C beta 1-Homo sapiens'
FamilyPhospholipases C
Sub-FamilyPhospholipases C beta
TypePhospholipase C beta 1
Cross References:
References
UniProtQ9NQ66 | O60325 | Q5TFF7 | Q5TGC9 | Q8IV93 | Q9BQW2 | Q9H4H2 | Q9H8H5
EMBLAJ278313 | AJ278314 | AY004175 | AB011153 | AL031683 | AL034551 | AL049593 | AL049632 | AL050315 | AL050323 | AL031683 | AL034551 | AL050315 | AL049632 | AL050323 | AL034551 | AL031683 | AL049593 | AL049632 | AL050315 | AL050323 | AL034551 | AL031683 | AL050315 | AL049632 | AL050323 | AL049593 | AL031683 | AL034551 | AL049632 | AL050315 | AL050323 | AL049632 | AL031683 | AL034551 | AL049593 | AL050315 | AL050323 | AL049632 | AL031683 | AL034551 | AL050315 | AL050323 | AL050315 | AL031683 | AL034551 | AL049593 | AL049632 | AL050323 | AL050315 | AL031683 | AL034551 | AL049632 | AL050323 | AL050323 | AL031683 | AL034551 | AL049593 | AL049632 | AL050315 | AL050323 | AL031683 | AL034551 | AL050315 | AL049632 | BC069420 | AL137267 | AK023689
InterProIPR000008 | IPR018029 | IPR011992 | IPR015359 | IPR001192 | IPR000909 | IPR001711 | IPR016280 | IPR014815 | IPR017946
PRODOMPD001202
GENEID23236
MIM607120
PRINTSPR00390
PFAMPF00168 | PF09279 | PF00388 | PF00387 | PF08703
Details:
Details
NamePhospholipase C beta 1-Homo sapiens
Description"RecName: Full=1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-1; EC=3.1.4.11;AltName: Full=Phosphoinositide phospholipase C;AltName: Full=Phospholipase C-beta-1; Short=PLC-beta-1;AltName: Full=PLC-I;AltName: Full=PLC-154;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePLCB1 | KIAA058
FunctionThe production of the second messenger moleculess diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) iss mediated by activated phosphatidylinositol-specific phospholipases C enzymes
Fragment0
Sequence
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-12_Homo sapiensStimulation15251227 | 11015615 | 8383116
2Ggamma-8_Homo sapiensStimulation15251227 | 11015615 | 8383116
3Ggamma-5_Homo sapiensStimulation15251227 | 11015615 | 8383116
4Ggamma-t1_Homo sapiensStimulation15251227 | 11015615 | 8383116
5Gbeta-like_Homo sapiens_1Stimulation15251227 | 11015615 | 8383116
6Gbeta-2_Homo sapiensStimulation15251227 | 11015615 | 8383116
7Ggamma-7_Homo sapiensStimulation15251227 | 11015615 | 8383116
8Ggamma-4_Homo sapiensStimulation15251227 | 11015615 | 8383116
9Galpha-15_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
10Ggamma-3_Homo sapiensStimulation15251227 | 11015615 | 8383116
11Ggamma-t2_Homo sapiensStimulation15251227 | 11015615 | 8383116
12Ggamma-13_Homo sapiensStimulation15251227 | 11015615 | 8383116
13Ggamma-10_Homo sapiensStimulation15251227 | 11015615 | 8383116
14Gbeta-3_Homo sapiensStimulation15251227 | 11015615 | 8383116
15Galpha-q_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
16Gbeta-5_Homo sapiensStimulation15251227 | 11015615 | 8383116
17Gbeta-1_Homo sapiensStimulation15251227 | 11015615 | 8383116
18Ggamma-2_Homo sapiensStimulation15251227 | 11015615 | 8383116
19Galpha-14_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
20Ggamma-11_Homo sapiensStimulation15251227 | 11015615 | 8383116
21Gbeta-4_Homo sapiensStimulation15251227 | 11015615 | 8383116
22Gbeta-like_Homo sapiens_2Stimulation15251227 | 11015615 | 8383116
23Galpha-11_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level