Quick search:







Description Entry page for Effector - 'Phospholipase C beta 2-Homo sapiens'
FamilyPhospholipases C
Sub-FamilyPhospholipases C beta
TypePhospholipase C beta 2
Cross References:
References
UniProtQ00722 | A8K6J2
EMBLM95678 | AK291657 | AC020658
InterProIPR000008 | IPR018029 | IPR011992 | IPR015359 | IPR001192 | IPR000909 | IPR001711 | IPR014815
PRODOMPD001202
GENEID5330
MIM604114
PRINTSPR00390
PFAMPF00168 | PF09279 | PF00388 | PF00387 | PF08703
Details:
Details
NamePhospholipase C beta 2-Homo sapiens
Description"RecName: Full=1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; EC=3.1.4.11;AltName: Full=Phosphoinositide phospholipase C;AltName: Full=Phospholipase C-beta-2; Short=PLC-beta-2;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePLCB
FunctionThe production of the second messenger moleculess diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) iss mediated by activated phosphatidylinositol-specific phospholipases C enzymes
Fragment0
Sequence
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-4_Homo sapiensStimulation15251227 | 11015615 | 8383116
2Ggamma-10_Homo sapiensStimulation15251227 | 11015615 | 8383116
3Ggamma-11_Homo sapiensStimulation15251227 | 11015615 | 8383116
4Gbeta-2_Homo sapiensStimulation15251227 | 11015615 | 8383116
5Gbeta-like_Homo sapiens_1Stimulation15251227 | 11015615 | 8383116
6Ggamma-t1_Homo sapiensStimulation15251227 | 11015615 | 8383116
7Galpha-q_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
8Ggamma-7_Homo sapiensStimulation15251227 | 11015615 | 8383116
9Galpha-14_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
10Ggamma-8_Homo sapiensStimulation15251227 | 11015615 | 8383116
11Galpha-15_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
12Ggamma-4_Homo sapiensStimulation15251227 | 11015615 | 8383116
13Galpha-11_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
14Gbeta-like_Homo sapiens_2Stimulation15251227 | 11015615 | 8383116
15Ggamma-t2_Homo sapiensStimulation15251227 | 11015615 | 8383116
16Ggamma-12_Homo sapiensStimulation15251227 | 11015615 | 8383116
17Ggamma-5_Homo sapiensStimulation15251227 | 11015615 | 8383116
18Gbeta-1_Homo sapiensStimulation15251227 | 11015615 | 8383116
19Ggamma-13_Homo sapiensStimulation15251227 | 11015615 | 8383116
20Gbeta-3_Homo sapiensStimulation15251227 | 11015615 | 8383116
21Ggamma-2_Homo sapiensStimulation15251227 | 11015615 | 8383116
22Ggamma-3_Homo sapiensStimulation15251227 | 11015615 | 8383116
23Gbeta-5_Homo sapiensStimulation15251227 | 11015615 | 8383116
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level