Quick search:







Description Entry page for Effector - 'Phospholipase C beta 3-Homo sapiens'
FamilyPhospholipases C
Sub-FamilyPhospholipases C beta
TypePhospholipase C beta 3
Cross References:
References
UniProtQ01970
EMBLU26425 | Z37544 | Z37545 | Z37546 | Z37547 | Z37548 | Z37549 | Z37550 | Z37551 | Z37552 | Z37553 | Z37554 | Z37555 | Z37556 | Z37557 | Z37558 | Z37559 | Z37560 | Z37561 | Z37562 | Z37564 | Z37565 | Z37566 | Z37567 | Z37568 | Z37569 | Z37570 | Z37571 | Z37572 | Z37573 | Z37574 | Z16411
InterProIPR000008 | IPR018029 | IPR011992 | IPR015359 | IPR001192 | IPR000909 | IPR001711 | IPR016280 | IPR014815 | IPR017946
PRODOMPD001202
GENEID5331
MIM600230
PRINTSPR00390
PFAMPF00168 | PF09279 | PF00388 | PF00387 | PF08703
Details:
Details
NamePhospholipase C beta 3-Homo sapiens
Description"RecName: Full=1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3; EC=3.1.4.11;AltName: Full=Phosphoinositide phospholipase C;AltName: Full=Phospholipase C-beta-3; Short=PLC-beta-3;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePLCB
FunctionThe production of the second messenger moleculess diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) iss mediated by activated phosphatidylinositol-specific phospholipases C enzymes
Fragment0
Sequence
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-5_Homo sapiensStimulation15251227 | 11015615 | 8383116
2Ggamma-8_Homo sapiensStimulation15251227 | 11015615 | 8383116
3Ggamma-t1_Homo sapiensStimulation15251227 | 11015615 | 8383116
4Ggamma-13_Homo sapiensStimulation15251227 | 11015615 | 8383116
5Ggamma-2_Homo sapiensStimulation15251227 | 11015615 | 8383116
6Gbeta-5_Homo sapiensStimulation15251227 | 11015615 | 8383116
7Gbeta-like_Homo sapiens_2Stimulation15251227 | 11015615 | 8383116
8Gbeta-3_Homo sapiensStimulation15251227 | 11015615 | 8383116
9Gbeta-1_Homo sapiensStimulation15251227 | 11015615 | 8383116
10Ggamma-7_Homo sapiensStimulation15251227 | 11015615 | 8383116
11Ggamma-10_Homo sapiensStimulation15251227 | 11015615 | 8383116
12Ggamma-4_Homo sapiensStimulation15251227 | 11015615 | 8383116
13Gbeta-4_Homo sapiensStimulation15251227 | 11015615 | 8383116
14Ggamma-12_Homo sapiensStimulation15251227 | 11015615 | 8383116
15Galpha-q_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
16Galpha-15_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
17Galpha-14_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
18Ggamma-3_Homo sapiensStimulation15251227 | 11015615 | 8383116
19Gbeta-2_Homo sapiensStimulation15251227 | 11015615 | 8383116
20Gbeta-like_Homo sapiens_1Stimulation15251227 | 11015615 | 8383116
21Ggamma-11_Homo sapiensStimulation15251227 | 11015615 | 8383116
22Galpha-11_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
23Ggamma-t2_Homo sapiensStimulation15251227 | 11015615 | 8383116
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level