Quick search:







Description Entry page for Effector - 'Phospholipase C beta 4-Homo sapiens'
FamilyPhospholipases C
Sub-FamilyPhospholipases C beta
TypePhospholipase C beta 4
Cross References:
References
UniProtQ15147 | B7ZLK6 | Q17R56 | Q5JYS8 | Q5JYT0 | Q5JYT3 | Q5JYT4 | Q9BQW5
EMBLL41349 | AL031652 | AL023805 | AL023805 | AL031652 | AL031652 | AL023805 | AL023805 | AL031652 | BC117458 | BC143868
InterProIPR000008 | IPR018029 | IPR009535 | IPR011992 | IPR015359 | IPR001192 | IPR000909 | IPR001711 | IPR016280 | IPR017946
PRODOMPD001202
GENEID5332
MIM600810
PRINTSPR00390
PFAMPF00168 | PF06631 | PF09279 | PF00388 | PF00387
Details:
Details
NamePhospholipase C beta 4-Homo sapiens
Description"RecName: Full=1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4; EC=3.1.4.11;AltName: Full=Phosphoinositide phospholipase C;AltName: Full=Phospholipase C-beta-4; Short=PLC-beta-4;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePLCB
FunctionThe production of the second messenger moleculess diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) iss mediated by activated phosphatidylinositol-specific phospholipases C enzymes
Fragment0
Sequence
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-q_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
2Galpha-11_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
3Galpha-15_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
4Galpha-14_Homo sapiensStimulation of PLC-beta catalytic activity15251227 | 16182515 | 11015615
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level