Quick search:







Description Entry page for Effector - 'PI3K alpha-Homo sapiens'
FamilyPI3/PI4 kinases
Sub-FamilyClass Ia PI3Ks
TypePI3K alpha
Cross References:
References
UniProtP42336 | Q14CW1 | Q99762
EMBLZ29090 | U79143 | BC113601 | BC113603
InterProIPR000008 | IPR000403 | IPR018936 | IPR002420 | IPR003113 | IPR000341 | IPR001263 | IPR015433
PRODOM
GENEID5290
MIM114480 | 114500 | 114550 | 167000 | 171834 | 182000
PRINTS
PFAMPF00454 | PF00792 | PF02192 | PF00794 | PF00613
Details:
Details
NamePI3K alpha-Homo sapiens
Description"RecName: Full=Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; EC=2.7.1.153;AltName: Full=PI3-kinase p110 subunit alpha;AltName: Full=PtdIns-3-kinase p110; Short=PI3K;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePIK3C
FunctionPhosphorylates PtdIns, PtdIns4P and PtdIns(4,5)P2 with as preference for PtdIns(4,5)P2
Fragment0
Sequence
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-2_Homo sapiensPropable Inhibition16182515
2Ggamma-3_Homo sapiensPropable Inhibition16182515
3Ggamma-13_Homo sapiensPropable Inhibition16182515
4Galpha-q_Homo sapiensInhibition of PI3K kinase activity in vitro16182515
5Ggamma-10_Homo sapiensPropable Inhibition16182515
6Ggamma-5_Homo sapiensPropable Inhibition16182515
7Gbeta-2_Homo sapiensPropable Inhibition16182515
8Gbeta-3_Homo sapiensPropable Inhibition16182515
9Gbeta-like_Homo sapiens_2Propable Inhibition16182515
10Gbeta-1_Homo sapiensPropable Inhibition16182515
11Gbeta-4_Homo sapiensPropable Inhibition16182515
12Ggamma-4_Homo sapiensPropable Inhibition16182515
13Ggamma-t1_Homo sapiensPropable Inhibition16182515
14Ggamma-8_Homo sapiensPropable Inhibition16182515
15Ggamma-12_Homo sapiensPropable Inhibition16182515
16Ggamma-11_Homo sapiensPropable Inhibition16182515
17Ggamma-t2_Homo sapiensPropable Inhibition16182515
18Gbeta-5_Homo sapiensPropable Inhibition16182515
19Ggamma-7_Homo sapiensPropable Inhibition16182515
20Gbeta-like_Homo sapiens_1Propable Inhibition16182515
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level