Quick search:







Description Entry page for Effector - 'PI3K beta-Homo sapiens'
FamilyPI3/PI4 kinases
Sub-FamilyClass Ia PI3Ks
TypePI3K beta
Cross References:
References
UniProtP42338 | Q24JU2
EMBLS67334 | AJ297549 | AJ297550 | AJ297551 | AJ297552 | AJ297553 | AJ297554 | AJ297555 | AJ297556 | AJ297557 | AJ297558 | AJ297559 | AJ297560 | BC114432
InterProIPR000403 | IPR018936 | IPR002420 | IPR003113 | IPR000341 | IPR001263 | IPR015433
PRODOM
GENEID5291
MIM602925
PRINTS
PFAMPF00454 | PF00792 | PF02192 | PF00794 | PF00613
Details:
Details
NamePI3K beta-Homo sapiens
Description"RecName: Full=Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform; EC=2.7.1.153;AltName: Full=PI3-kinase p110 subunit beta;AltName: Full=PtdIns-3-kinase p110;AltName: Full=PI3Kbeta; Short=PI3K;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePIK3CB | PIK3C
FunctionPhosphorylates PtdIns, PtdIns4P and PtdIns(4,5)P2 with as preference for PtdIns(4,5)P2
Fragment0
Sequence
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-1_Homo sapiensActivation9305878 | 12502714
2Ggamma-4_Homo sapiensActivation9305878 | 12502714
3Gbeta-4_Homo sapiensActivation9305878 | 12502714
4Ggamma-11_Homo sapiensActivation9305878 | 12502714
5Gbeta-3_Homo sapiensActivation9305878 | 12502714
6Gbeta-5_Homo sapiensActivation9305878 | 12502714
7Ggamma-t2_Homo sapiensActivation9305878 | 12502714
8Ggamma-2_Homo sapiensActivation9305878 | 12502714
9Ggamma-12_Homo sapiensActivation9305878 | 12502714
10Ggamma-13_Homo sapiensActivation9305878 | 12502714
11Ggamma-t1_Homo sapiensActivation9305878 | 12502714
12Gbeta-like_Homo sapiens_1Activation9305878 | 12502714
13Ggamma-10_Homo sapiensActivation9305878 | 12502714
14Gbeta-like_Homo sapiens_2Activation9305878 | 12502714
15Ggamma-3_Homo sapiensActivation9305878 | 12502714
16Ggamma-5_Homo sapiensActivation9305878 | 12502714
17Gbeta-2_Homo sapiensActivation9305878 | 12502714
18Galpha-q_Homo sapiensInhibition of PI3K kinase activity in vitro16182515
19Ggamma-8_Homo sapiensActivation9305878 | 12502714
20Ggamma-7_Homo sapiensActivation9305878 | 12502714
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level