Quick search:







Description Entry page for Effector - 'PI3K gamma-Homo sapiens'
FamilyPI3/PI4 kinases
Sub-FamilyClass Ib PI3Ks
TypePI3K gamma
Cross References:
References
UniProtP48736 | Q8IV23 | Q9BZC8
EMBLX83368 | AF327656 | AC005018 | BC035683
InterProIPR000403 | IPR018936 | IPR002420 | IPR000341 | IPR001263 | IPR015433
PRODOM
GENEID5294
MIM601232
PRINTS
PFAMPF00454 | PF00792 | PF00794 | PF00613
Details:
Details
NamePI3K gamma-Homo sapiens
Description"RecName: Full=Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform; EC=2.7.1.153;AltName: Full=PI3-kinase p110 subunit gamma;AltName: Full=PtdIns-3-kinase subunit p110;AltName: Full=PI3Kgamma; Short=PI3K;AltName: Full=p120-PI3K;"
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePIK3C
Function3-phosphorylates the cellular phosphoinositide PtdIns-s 4,5-biphosphate (PtdIns(4,5)P2) to produce PtdIns-3, 4,5-s triiphosphate (PtdIns(3,4,5)P3)
Fragment0
Sequence
MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRKCKSPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKATHRSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGL
VTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDT
PGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIEMLQKVTLDIKSLSAEKYDVSSQVISQLKQKLENLQNSQLP
ESFRVPYDPGLKAGALAIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-3_Homo sapiensActivation12502714
2Ggamma-3_Homo sapiensActivation12502714
3Ggamma-10_Homo sapiensActivation12502714
4Ggamma-5_Homo sapiensActivation12502714
5Ggamma-7_Homo sapiensActivation12502714
6Ggamma-t1_Homo sapiensActivation12502714
7Gbeta-2_Homo sapiensActivation12502714
8Ggamma-4_Homo sapiensActivation12502714
9Ggamma-12_Homo sapiensActivation12502714
10Gbeta-like_Homo sapiens_1Activation12502714
11Ggamma-11_Homo sapiensActivation12502714
12Gbeta-like_Homo sapiens_2Activation12502714
13Ggamma-13_Homo sapiensActivation12502714
14Ggamma-8_Homo sapiensActivation12502714
15Ggamma-2_Homo sapiensActivation12502714
16Ggamma-t2_Homo sapiensActivation12502714
17Gbeta-1_Homo sapiensActivation12502714
18Galpha-q_Homo sapiensInhibition of PI3K kinase activity in vitro16182515
19Gbeta-5_Homo sapiensActivation12502714
20Gbeta-4_Homo sapiensActivation12502714
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level