Quick search:







Description Entry page for Effector - 'Protein kinase D-Homo sapiens'
FamilySer Thr protein kinases
Sub-FamilyProtein kinases C(PKC)
TypeProtein kinase D
Cross References:
References
UniProtQ15139 | A6NL64 | B2RAF6
EMBLX75756 | AK314170 | AL135858 | CH471078
InterProIPR020454 | IPR011993 | IPR001849 | IPR002219 | IPR000719 | IPR017441 | IPR015727 | IPR017442 | IPR008271 | IPR002290
PRODOMPD000001
GENEID5587
MIM605435
PRINTSPR00008
PFAMPF00130 | PF00169 | PF00069
Details:
Details
NameProtein kinase D-Homo sapiens
DescriptionRecName: Full=Serine/threonine-protein kinase D1; EC=2.7.11.13;AltName: Full=nPKC-D1;AltName: Full=Protein kinase D;AltName: Full=Protein kinase C mu type;AltName: Full=nPKC-mu
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GenePRKD1 | PKD,PKD1,PRKC
FunctionConverts transient diacylglycerol (DAG) signals intos prolonged physiological effects, downstream of PKC
Fragment0
Sequence
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-1_Homo sapiensStimulation15251227
2Gbeta-2_Homo sapiensStimulation15251227
3Ggamma-t1_Homo sapiensStimulation15251227
4Ggamma-3_Homo sapiensStimulation15251227
5Ggamma-7_Homo sapiensStimulation15251227
6Ggamma-5_Homo sapiensStimulation15251227
7Ggamma-t2_Homo sapiensStimulation15251227
8Galpha-q_Homo sapiensStimulation10636921
9Ggamma-8_Homo sapiensStimulation15251227
10Ggamma-12_Homo sapiensStimulation15251227
11Ggamma-2_Homo sapiensStimulation15251227
12Ggamma-4_Homo sapiensStimulation15251227
13Gbeta-like_Homo sapiens_2Stimulation15251227
14Ggamma-13_Homo sapiensStimulation15251227
15Ggamma-11_Homo sapiensStimulation15251227
16Gbeta-like_Homo sapiens_1Stimulation15251227
17Gbeta-4_Homo sapiensStimulation15251227
18Gbeta-3_Homo sapiensStimulation15251227
19Gbeta-5_Homo sapiensStimulation15251227
20Ggamma-10_Homo sapiensStimulation15251227
21Galpha-13_Homo sapiensStimulation11507098
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level