Quick search:







Description Entry page for Effector - 'Adenylate cyclase 5-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 5
Cross References:
References
UniProtO95622 | Q7RTV7 | Q8NFM3
EMBLAC025571 | AF497517 | U65473 | BK000371
InterProIPR001054 | IPR018297 | IPR009398
PRODOM
GENEID111
MIM600293
PRINTS
PFAMPF06327 | PF00211
Details:
Details
NameAdenylate cyclase 5-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 5; EC=4.6.1.1;AltName: Full=Adenylate cyclase type V;AltName: Full=ATP pyrophosphate-lyase 5;AltName: Full=Adenylyl cyclase 5
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY
FunctionThis is a membrane-bound, calcium-inhibitable adenylyls cyclase
Fragment0
Sequence
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEG
GEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQS
SLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL
HLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
GMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMN
RQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFL
GRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQI
TIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
TITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADL
LVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
2Gbeta-like_Homo sapiens_2Inhibition15251227 | 15922020 | 14993377 | 11376933
3Ggamma-11_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
4Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
5Ggamma-12_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
6Ggamma-t2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
7Ggamma-13_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
8Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
9Ggamma-8_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
10Gbeta-1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
11Ggamma-7_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
12Galpha-o_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
13Ggamma-t1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
14Ggamma-3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
15Galpha-i1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
16Gbeta-5_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
17Ggamma-4_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
18Ggamma-2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
19Gbeta-3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
20Galpha-i2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
21Ggamma-5_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
22Gbeta-4_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
23Gbeta-2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
24Gbeta-like_Homo sapiens_1Inhibition15251227 | 15922020 | 14993377 | 11376933
25Ggamma-10_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level