Quick search:







Description Entry page for Effector - 'Rac-Homo sapiens-1'
FamilySmall GTP-binding proteins
Sub-FamilyRho small GTPases
TypeRac
Cross References:
References
UniProtP63000 | O95501 | P15154 | Q3Y4D3 | Q5JAA8 | Q9BTB4
EMBLM29870 | M31467 | AJ132694 | AJ132695 | AJ132695 | AF136373 | AY279384 | AF498964 | BT007121 | DQ165078 | AC009412 | AC009412 | BC004247 | BC050687 | BC107748
InterProIPR003578 | IPR013753 | IPR001806 | IPR005225
PRODOM
GENEID5879
MIM602048
PRINTSPR00449
PFAMPF00071
Details:
Details
NameRac-Homo sapiens-1
DescriptionRecName: Full=Ras-related C3 botulinum toxin substrate 1;AltName: Full=p21-Rac1;AltName: Full=Ras-like protein TC25;AltName: Full=Cell migration-inducing gene 5 protein;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneRAC1 | MIG
FunctionPlasma membrane-associated small GTPase which cycless between active GTP-bound and inactive GDP-bound states
Fragment0
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i2_Homo sapiensStimulation11099498
2Ggamma-2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
3Ggamma-5_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Ggamma-4_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
5Gbeta-3_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
6Gbeta-5_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
7Ggamma-13_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
8Ggamma-3_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
9Gbeta-like_Homo sapiens_2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
10Ggamma-7_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
11Ggamma-t1_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
12Ggamma-11_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
13Galpha-i3_Homo sapiensStimulation11099498
14Ggamma-10_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
15Gbeta-2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Galpha-i1_Homo sapiensStimulation11099498
17Gbeta-like_Homo sapiens_1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
18Gbeta-1_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
19Ggamma-t2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
20Ggamma-8_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
21Gbeta-4_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
22Ggamma-12_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level