Quick search:







Description Entry page for Effector - 'Rac-Homo sapiens-2'
FamilySmall GTP-binding proteins
Sub-FamilyRho small GTPases
TypeRac
Cross References:
References
UniProtP15153
EMBLM29871 | AF498965 | CR456555 | BT006919 | Z82188 | BC001485 | M64595
InterProIPR003578 | IPR013753 | IPR001806 | IPR005225
PRODOM
GENEID5880
MIM602049 | 608203
PRINTSPR00449
PFAMPF00071
Details:
Details
NameRac-Homo sapiens-2
DescriptionRecName: Full=Ras-related C3 botulinum toxin substrate 2;AltName: Full=p21-Rac2;AltName: Full=Small G protein;AltName: Full=GX;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneRAC
FunctionPlasma membrane-associated small GTPase which cycless between an active GTP-bound and inactive GDP-bound state
Fragment0
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-7_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
2Gbeta-4_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
3Ggamma-t2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
4Ggamma-8_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
5Ggamma-t1_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
6Ggamma-11_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
7Ggamma-5_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
8Gbeta-like_Homo sapiens_2"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
9Gbeta-2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
10Galpha-i3_Homo sapiensStimulation11099498
11Galpha-i2_Homo sapiensStimulation11099498
12Gbeta-5_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
13Ggamma-2_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
14Gbeta-1_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
15Gbeta-3_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
16Ggamma-4_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
17Galpha-i1_Homo sapiensStimulation11099498
18Ggamma-10_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
19Ggamma-13_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
20Ggamma-3_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
21Ggamma-12_Homo sapiens"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
22Gbeta-like_Homo sapiens_1"Stimulation,Recruitment to plasma membrane"11099498 | 15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level