Quick search:







Description Entry page for Effector - 'Rap1GAPII-Homo sapiens-1'
FamilyGTPase activating proteins
Sub-FamilyRap-specific GAPs
TypeRap1GAPII
Cross References:
References
UniProtP47736 | O75062 | Q5T3T4
EMBLM64788 | AB007943 | AL359815 | CH471134
InterProIPR003109 | IPR000331
PRODOM
GENEID5909
MIM600278
PRINTS
PFAMPF02188 | PF02145
Details:
Details
NameRap1GAPII-Homo sapiens-1
DescriptionRecName: Full=Rap1 GTPase-activating protein 1; Short=Rap1GAP1; Short=Rap1GAP
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneRAP1GAP | KIAA0474,RAP1GA
FunctionGTPase activator for the nuclear Ras-related regulatorys protein RAP-1A (KREV-1), converting it to the putatively inactives GDP-bound state
Fragment0
Sequence
MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTN
HEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDV
IGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRL
IVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR
GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDE
NTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPE
FQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIV
PGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQ
SSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGT
PHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ
LGC
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i3_Homo sapiensSequestration of RAP1GAP10476970 | 15251227
2Galpha-i1_Homo sapiensSequestration of RAP1GAP10476970 | 15251227
3Galpha-i2_Homo sapiensSequestration of RAP1GAP10476970 | 15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level