Quick search:







Description Entry page for Effector - 'Rap1GAPII-Homo sapiens-2'
FamilyGTPase activating proteins
Sub-FamilyRap-specific GAPs
TypeRap1GAPII
Cross References:
References
UniProtQ684P5 | B2RTY5 | Q684P4 | Q6AI00 | Q6ZVF0 | Q9UPW2
EMBLAJ628446 | AJ628447 | AK124640 | CR627427 | BC140870 | BC140871 | AB028962
InterProIPR000331
PRODOM
GENEID23108
MIM
PRINTS
PFAMPF02145
Details:
Details
NameRap1GAPII-Homo sapiens-2
DescriptionRecName: Full=Rap1 GTPase-activating protein 2; Short=Rap1GAP2;AltName: Full=GTPase-activating Rap/Ran-GAP domain-like protein 4
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneGARNL4 | KIAA1039,RAP1GA
FunctionGTPase activator for the nuclear Ras-related regulatorys protein RAP-1A (KREV-1), converting it to the putatively inactives GDP-bound state
Fragment0
Sequence
MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFF
EMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPENV
GTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLI
LSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQIAKAFCDDAVGLRFNPVL
YPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITL
QDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQRKRHIGNDIV
AIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGPPLPSPP
VFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQAMLGLGP
EEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGISHNSMEVTK
TTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEGQGDSRARCDSTSSTPKTPDGGHSS
QEIKSETSSNPSSPEICPNKEKPFMKLKENGRAISRSSSSTSSVSSTAGEGEAMEEGDSG
GSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRSPTDAKSRNSPRSNLKFRFDK
LSHASSGAGH
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i2_Homo sapiensSequestration of RAP1GAP10476970 | 15251227
2Galpha-i1_Homo sapiensSequestration of RAP1GAP10476970 | 15251227
3Galpha-i3_Homo sapiensSequestration of RAP1GAP10476970 | 15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level