Quick search:







Description Entry page for Effector - 'RGS PX1-Homo sapiens'
FamilyRegulators of G-protein signaling
Sub-FamilyRegulators of G-protein signaling
TypeRGS PX1
Cross References:
References
UniProtQ9Y5W8 | B2RCI9 | O94821 | Q8WVZ2 | Q8WXH8
EMBLAF420470 | AB018256 | AK315135 | AF121862 | CH471073 | BC022060
InterProIPR003114 | IPR001683 | IPR013996 | IPR000342 | IPR013937
PRODOMPD001580
GENEID23161
MIM606589
PRINTS
PFAMPF08628 | PF00787 | PF02194 | PF00615
Details:
Details
NameRGS PX1-Homo sapiens
DescriptionRecName: Full=Sorting nexin-13;AltName: Full=RGS domain- and PHOX domain-containing protein;AltName: Full=RGS-PX1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneSNX13 | KIAA071
FunctionMay be involved in several stages of intracellulars trafficking
Fragment0
Sequence
MLTEASLSIWGWGSLGIVLFLITFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLE
QCEHSFLPPTSPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKIT
EKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGD
FQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNI
GELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTV
KLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVL
LSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPE
IFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPT
GSINLSLDDLSNVSSDDSVQLHAYISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRN
LNSEEMWKTYRRYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAY
LQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKS
LPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDD
NIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQ
VADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRK
GILRVFEMFQHNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTT
QAPSLQKR
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-s_Homo sapiens_1Stimulation15251227
2Galpha-s_Homo sapiens_2Stimulation15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level