Quick search:







Description Entry page for Effector - 'Rho-Homo sapiens-1'
FamilySmall GTP-binding proteins
Sub-FamilyRho small GTPases
TypeRho
Cross References:
References
UniProtQ92730 | A8K9P7
EMBLY07923 | AB040147 | AF498967 | AK292762 | CH471111 | BC026356
InterProIPR003578 | IPR013753 | IPR001806 | IPR005225
PRODOM
GENEID27289
MIM609038
PRINTSPR00449
PFAMPF00071
Details:
Details
NameRho-Homo sapiens-1
DescriptionRecName: Full=Rho-related GTP-binding protein Rho6;AltName: Full=Rho family GTPase 1;AltName: Full=Rnd1;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneRND1 | RHO
FunctionLacks intrinsic GTPase activity
Fragment0
Sequence
MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQR
VELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRV
LLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIF
RTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-5_Homo sapiensRecruitment to plasma membrane15251227
2Gbeta-5_Homo sapiensRecruitment to plasma membrane15251227
3Gbeta-4_Homo sapiensRecruitment to plasma membrane15251227
4Gbeta-like_Homo sapiens_1Recruitment to plasma membrane15251227
5Gbeta-3_Homo sapiensRecruitment to plasma membrane15251227
6Ggamma-11_Homo sapiensRecruitment to plasma membrane15251227
7Gbeta-like_Homo sapiens_2Recruitment to plasma membrane15251227
8Ggamma-t2_Homo sapiensRecruitment to plasma membrane15251227
9Ggamma-7_Homo sapiensRecruitment to plasma membrane15251227
10Ggamma-8_Homo sapiensRecruitment to plasma membrane15251227
11Ggamma-10_Homo sapiensRecruitment to plasma membrane15251227
12Ggamma-4_Homo sapiensRecruitment to plasma membrane15251227
13Ggamma-t1_Homo sapiensRecruitment to plasma membrane15251227
14Gbeta-2_Homo sapiensRecruitment to plasma membrane15251227
15Ggamma-13_Homo sapiensRecruitment to plasma membrane15251227
16Ggamma-3_Homo sapiensRecruitment to plasma membrane15251227
17Ggamma-2_Homo sapiensRecruitment to plasma membrane15251227
18Gbeta-1_Homo sapiensRecruitment to plasma membrane15251227
19Ggamma-12_Homo sapiensRecruitment to plasma membrane15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level