Quick search:







Description Entry page for Effector - 'Adenylate cyclase 6-Homo sapiens'
FamilyCyclases
Sub-FamilyAdenylate cyclases
TypeAdenylate cyclase 6
Cross References:
References
UniProtO43306 | Q9NR75
EMBLAF250226 | AB007882 | BC064923
InterProIPR001054 | IPR018297 | IPR009398
PRODOM
GENEID112
MIM600294
PRINTS
PFAMPF06327 | PF00211
Details:
Details
NameAdenylate cyclase 6-Homo sapiens
DescriptionRecName: Full=Adenylate cyclase type 6; EC=4.6.1.1;AltName: Full=Adenylate cyclase type VI;AltName: Full=ATP pyrophosphate-lyase 6;AltName: Full=Adenylyl cyclase 6;AltName: Full=Ca(2+)-inhibitable adenylyl cyclase
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneADCY6 | KIAA042
FunctionMembrane-bound, calcium-inhibitable adenylyl cyclase (Bys similarity)
Fragment0
Sequence
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
2Ggamma-4_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
3Galpha-s_Homo sapiens_2Stimulation15251227 | 15922020 | 14993377 | 11376933
4Galpha-i1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
5Galpha-s_Homo sapiens_1Stimulation15251227 | 15922020 | 14993377 | 11376933
6Gbeta-like_Homo sapiens_2Inhibition15251227 | 15922020 | 14993377 | 11376933
7Ggamma-5_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
8Galpha-o_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
9Gbeta-1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
10Ggamma-11_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
11Galpha-i2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
12Ggamma-8_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
13Ggamma-3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
14Ggamma-7_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
15Gbeta-like_Homo sapiens_1Inhibition15251227 | 15922020 | 14993377 | 11376933
16Ggamma-10_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
17Gbeta-4_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
18Ggamma-12_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
19Galpha-i3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
20Ggamma-t2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
21Gbeta-5_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
22Ggamma-13_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
23Ggamma-2_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
24Gbeta-3_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
25Ggamma-t1_Homo sapiensInhibition15251227 | 15922020 | 14993377 | 11376933
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level