Quick search:







Description Entry page for Effector - 'Rho-Homo sapiens-2'
FamilySmall GTP-binding proteins
Sub-FamilyRho small GTPases
TypeRho
Cross References:
References
UniProtP52198 | A8K2D4 | O00690 | O00734 | Q5U0P6 | Q99535
EMBLX95456 | L78833 | AF498968 | BT019394 | AK290199 | CH471152 | BC094842 | BC104986 | BC104990
InterProIPR003578 | IPR013753 | IPR001806 | IPR005225
PRODOM
GENEID8153
MIM601555
PRINTSPR00449
PFAMPF00071
Details:
Details
NameRho-Homo sapiens-2
DescriptionRecName: Full=Rho-related GTP-binding protein RhoN;AltName: Full=Rho family GTPase 2;AltName: Full=Rnd2;AltName: Full=Rho7;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneRND2 | ARHN,RHO
FunctionMay be specifically involved in neuronal and hepatics functions
Fragment0
Sequence
MEGQSGRCKIVVVGDAECGKTALLQVFAKDAYPGSYVPTVFENYTASFEIDKRRIELNMW
DTSGSSYYDNVRPLAYPDSDAVLICFDISRPETLDSVLKKWQGETQEFCPNAKVVLVGCK
LDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATVA
SLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCNLM
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-13_Homo sapiensRecruitment to plasma membrane15251227
2Ggamma-t2_Homo sapiensRecruitment to plasma membrane15251227
3Ggamma-t1_Homo sapiensRecruitment to plasma membrane15251227
4Ggamma-10_Homo sapiensRecruitment to plasma membrane15251227
5Ggamma-3_Homo sapiensRecruitment to plasma membrane15251227
6Ggamma-12_Homo sapiensRecruitment to plasma membrane15251227
7Gbeta-5_Homo sapiensRecruitment to plasma membrane15251227
8Gbeta-2_Homo sapiensRecruitment to plasma membrane15251227
9Gbeta-like_Homo sapiens_1Recruitment to plasma membrane15251227
10Gbeta-3_Homo sapiensRecruitment to plasma membrane15251227
11Gbeta-1_Homo sapiensRecruitment to plasma membrane15251227
12Gbeta-4_Homo sapiensRecruitment to plasma membrane15251227
13Gbeta-like_Homo sapiens_2Recruitment to plasma membrane15251227
14Ggamma-4_Homo sapiensRecruitment to plasma membrane15251227
15Ggamma-5_Homo sapiensRecruitment to plasma membrane15251227
16Ggamma-11_Homo sapiensRecruitment to plasma membrane15251227
17Ggamma-8_Homo sapiensRecruitment to plasma membrane15251227
18Ggamma-2_Homo sapiensRecruitment to plasma membrane15251227
19Ggamma-7_Homo sapiensRecruitment to plasma membrane15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level