Quick search:







Description Entry page for Effector - 'Rho-Homo sapiens-3'
FamilySmall GTP-binding proteins
Sub-FamilyRho small GTPases
TypeRho
Cross References:
References
UniProtP61587 | P52199
EMBLX95282 | X97758 | AF498969 | BT006769 | BC012513 | S82240
InterProIPR003578 | IPR013753 | IPR001806 | IPR005225
PRODOM
GENEID390
MIM602924
PRINTSPR00449
PFAMPF00071
Details:
Details
NameRho-Homo sapiens-3
DescriptionRecName: Full=Rho-related GTP-binding protein RhoE;AltName: Full=Rho family GTPase 3;AltName: Full=Rnd3;AltName: Full=Rho8;AltName: Full=MemB protein;Flags: Precursor
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneRND3 | ARHE,RHO8,RHO
FunctionBinds GTP but lacks intrinsic GTPase activity and iss resistant to Rho-specific GTPase-activating proteins
Fragment0
Sequence
MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENY
TASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGE
IQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL
QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKS
CTVM
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-t1_Homo sapiensRecruitment to plasma membrane15251227
2Ggamma-11_Homo sapiensRecruitment to plasma membrane15251227
3Ggamma-7_Homo sapiensRecruitment to plasma membrane15251227
4Ggamma-10_Homo sapiensRecruitment to plasma membrane15251227
5Ggamma-4_Homo sapiensRecruitment to plasma membrane15251227
6Ggamma-12_Homo sapiensRecruitment to plasma membrane15251227
7Ggamma-3_Homo sapiensRecruitment to plasma membrane15251227
8Gbeta-like_Homo sapiens_2Recruitment to plasma membrane15251227
9Gbeta-like_Homo sapiens_1Recruitment to plasma membrane15251227
10Ggamma-8_Homo sapiensRecruitment to plasma membrane15251227
11Gbeta-3_Homo sapiensRecruitment to plasma membrane15251227
12Gbeta-4_Homo sapiensRecruitment to plasma membrane15251227
13Ggamma-2_Homo sapiensRecruitment to plasma membrane15251227
14Gbeta-5_Homo sapiensRecruitment to plasma membrane15251227
15Ggamma-t2_Homo sapiensRecruitment to plasma membrane15251227
16Gbeta-1_Homo sapiensRecruitment to plasma membrane15251227
17Ggamma-13_Homo sapiensRecruitment to plasma membrane15251227
18Gbeta-2_Homo sapiensRecruitment to plasma membrane15251227
19Ggamma-5_Homo sapiensRecruitment to plasma membrane15251227
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level