Quick search:







Description Entry page for Effector - 'SHC transforming protein 1-Homo sapiens'
FamilySHC transforming proteins
Sub-FamilySHC transforming proteins
TypeSHC transforming protein 1
Cross References:
References
UniProtP29353 | O15290 | Q5T180 | Q5T183 | Q5T184 | Q5T185 | Q5T186 | Q8N4K5
EMBLX68148 | U73377 | Y09847 | AK292143 | AK315842 | AL451085 | AL451085 | AL451085 | AL451085 | AL451085 | CH471121 | CH471121 | CH471121 | BC014158 | BC033925
InterProIPR011993 | IPR006019 | IPR006020 | IPR000980
PRODOMPD000093
GENEID6464
MIM600560
PRINTSPR00401 | PR00629
PFAMPF00640 | PF00017
Details:
Details
NameSHC transforming protein 1-Homo sapiens
DescriptionRecName: Full=SHC-transforming protein 1;AltName: Full=Src homology 2 domain-containing-transforming protein C1; Short=SH2 domain protein C1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneSHC1 | SHC,SHC
FunctionSignaling adapter that couples activated growth factors receptors to signaling pathway
Fragment0
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Gbeta-4_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
2Gbeta-1_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
3Ggamma-t1_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
4Ggamma-2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
5Ggamma-5_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
6Ggamma-4_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
7Ggamma-8_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
8Ggamma-11_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9Ggamma-t2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
10Ggamma-3_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
11Gbeta-3_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
12Ggamma-10_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
13Ggamma-13_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
14Gbeta-5_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
15Gbeta-like_Homo sapiens_1Stimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
16Gbeta-like_Homo sapiens_2Stimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
17Gbeta-2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
18Ggamma-7_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
19Ggamma-12_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level