Quick search:







Description Entry page for Effector - 'SHC transforming protein 2-Homo sapiens'
FamilySHC transforming proteins
Sub-FamilySHC transforming proteins
TypeSHC transforming protein 2
Cross References:
References
UniProtP98077 | O60230 | Q9NPL5 | Q9UCX4
EMBLAC008988 | AC138433 | AC006124 | AB001451 | AL360254
InterProIPR011993 | IPR006019 | IPR006020 | IPR000980
PRODOMPD000093
GENEID25759
MIM605217
PRINTSPR00401 | PR00629
PFAMPF00640 | PF00017
Details:
Details
NameSHC transforming protein 2-Homo sapiens
DescriptionRecName: Full=SHC-transforming protein 2;AltName: Full=Src homology 2 domain-containing-transforming protein C2; Short=SH2 domain protein C2;AltName: Full=Protein Sck
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneSHC2 | SCK,SHC
FunctionSignaling adapter that couples activated growth factors receptors to signaling pathway in neurons
Fragment0
Sequence
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGA
DPQPEPAGPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAA
AAAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTR
EAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQ
VIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFEL
RFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALT
QPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEE
QLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGV
VRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-5_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
2Ggamma-11_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
3Gbeta-4_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
4Ggamma-2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
5Ggamma-3_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
6Ggamma-10_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
7Ggamma-13_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
8Gbeta-5_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9Gbeta-like_Homo sapiens_2Stimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
10Ggamma-t1_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
11Gbeta-1_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
12Gbeta-like_Homo sapiens_1Stimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
13Ggamma-4_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
14Ggamma-8_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
15Gbeta-2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
16Ggamma-t2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
17Ggamma-7_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
18Gbeta-3_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
19Ggamma-12_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level