Quick search:







Description Entry page for Effector - 'SHC transforming protein 3-Homo sapiens'
FamilySHC transforming proteins
Sub-FamilySHC transforming proteins
TypeSHC transforming protein 3
Cross References:
References
UniProtQ92529 | Q8TAP2 | Q9UCX5
EMBLD84361 | D84361 | BC026314
InterProIPR011993 | IPR006019 | IPR006020 | IPR000980
PRODOMPD000093
GENEID53358
MIM605263
PRINTSPR00401 | PR00629
PFAMPF00640 | PF00017
Details:
Details
NameSHC transforming protein 3-Homo sapiens
DescriptionRecName: Full=SHC-transforming protein 3;AltName: Full=Src homology 2 domain-containing-transforming protein C3; Short=SH2 domain protein C3;AltName: Full=Neuronal Shc; Short=N-Shc;AltName: Full=Protein Rai
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneSHC3 | NSHC,SHC
FunctionSignaling adapter that couples activated growth factors receptors to signaling pathway in neurons
Fragment0
Sequence
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPA
MSAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDTRL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISP
VSPRAPDAKMLEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Ggamma-12_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
2Ggamma-8_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
3Gbeta-4_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
4Ggamma-13_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
5Gbeta-2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
6Gbeta-3_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
7Ggamma-10_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
8Ggamma-2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
9Gbeta-like_Homo sapiens_1Stimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
10Ggamma-4_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
11Ggamma-7_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
12Gbeta-1_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
13Gbeta-like_Homo sapiens_2Stimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
14Ggamma-t1_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
15Gbeta-5_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
16Ggamma-5_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
17Ggamma-11_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
18Ggamma-t2_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
19Ggamma-3_Homo sapiensStimulation(indirect activation of MAPK)15251227 | 14671004 | 7568118
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level