Quick search:







Description Entry page for Effector - 'Src tyrosine kinase-Homo sapiens-1'
FamilyTyr protein kinases
Sub-FamilyTyr protein kinases
TypeSrc tyrosine kinase
Cross References:
References
UniProtP41240 | Q2M3N2 | Q6FGZ6
EMBLX60114 | X59932 | X74765 | CR541960 | DQ075211 | BC104847 | BC104875 | BC106073
InterProIPR000719 | IPR017441 | IPR000980 | IPR001452 | IPR001245 | IPR008266 | IPR015778
PRODOMPD000001 | PD000093 | PD000066
GENEID1445
MIM124095
PRINTSPR00401 | PR00109
PFAMPF07714 | PF00017 | PF00018
Details:
Details
NameSrc tyrosine kinase-Homo sapiens-1
DescriptionRecName: Full=Tyrosine-protein kinase CSK; EC=2.7.10.2;AltName: Full=C-SRC kinase;AltName: Full=Protein-tyrosine kinase CYL
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneCS
FunctionSpecifically phosphorylates 'Tyr-504' on LCK, which actss as a negative regulatory site
Fragment0
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i2_Homo sapiensStimulation11007482 | 15251227 | 12209124
2Galpha-s_Homo sapiens_1Stimulation11007482 | 15251227 | 12209124
3Galpha-i1_Homo sapiensStimulation11007482 | 15251227 | 12209124
4Galpha-s_Homo sapiens_2Stimulation11007482 | 15251227 | 12209124
5Galpha-o_Homo sapiensStimulation11007482 | 15251227 | 12209124
6Galpha-i3_Homo sapiensStimulation11007482 | 15251227 | 12209124
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level