Quick search:







Description Entry page for Effector - 'Src tyrosine kinase-Homo sapiens-2'
FamilyTyr protein kinases
Sub-FamilyTyr protein kinases
TypeSrc tyrosine kinase
Cross References:
References
UniProtP12931 | Q86VB9 | Q9H5A8
EMBLAL133293 | BC011566 | BC051270 | K03218 | M16237 | M16243 | M16244 | M16245 | K03212 | K03213 | K03214 | K03215 | K03216 | K03217 | X02647 | X03995 | X03996 | X03997 | X03998 | X03999 | X04000
InterProIPR000719 | IPR017441 | IPR000980 | IPR001452 | IPR020473 | IPR001245 | IPR008266
PRODOMPD000001 | PD000093 | PD000066
GENEID6714
MIM190090
PRINTSPR00401 | PR00452 | PR00109
PFAMPF07714 | PF00017 | PF00018
Details:
Details
NameSrc tyrosine kinase-Homo sapiens-2
DescriptionRecName: Full=Proto-oncogene tyrosine-protein kinase Src; EC=2.7.10.2;AltName: Full=pp60c-src; Short=p60-Src; Short=c-Src
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneSRC | SRC
Function
Fragment0
Sequence
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-i2_Homo sapiensStimulation11007482 | 15251227 | 12209124
2Galpha-i1_Homo sapiensStimulation11007482 | 15251227 | 12209124
3Galpha-i3_Homo sapiensStimulation11007482 | 15251227 | 12209124
4Galpha-s_Homo sapiens_1Stimulation11007482 | 15251227 | 12209124
5Galpha-s_Homo sapiens_2Stimulation11007482 | 15251227 | 12209124
6Galpha-o_Homo sapiensStimulation11007482 | 15251227 | 12209124
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level