Quick search:







Description Entry page for Effector - 'TPR repeat protein 1-Homo sapiens'
FamilyTPR repeat proteins
Sub-FamilyTPR repeat proteins
TypeTPR repeat protein 1
Cross References:
References
UniProtQ99614 | B2RCT2 | Q9BVT3
EMBLU46570 | AK315262 | CH471062 | BC000942
InterProIPR001440 | IPR011990 | IPR013026 | IPR019734
PRODOM
GENEID7265
MIM601963
PRINTS
PFAMPF00515
Details:
Details
NameTPR repeat protein 1-Homo sapiens
DescriptionRecName: Full=Tetratricopeptide repeat protein 1; Short=TPR repeat protein 1
SpeciesHomo sapiens
Common NameHuman
NCBI Taxonomy9606
GeneTTC1 | TPR
Function
Fragment0
Sequence
MGEKSENCGVPEDLLNGLKVTDTQEAECAGPPVPDPKNQHSQSKLLRDDEAHLQEDQGEE
ECFHDCSASFEEEPGADKVENKSNEDVNSSELDEEYLIELEKNMSDEEKQKRREESTRLK
EEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSILFSNRAAARMKQDKKEMAINDCSK
AIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERN
ERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Interacting with G-proteins:
G-proteins
NoNameRegulationPubMed
1Galpha-15_Homo sapiensG16a co-expression enhances TPR1 interaction with Ras16182515 | 12748287
2Galpha-q_Homo sapiensG16a co-expression enhances TPR1 interaction with Ras16182515 | 12748287
GPCR, G-protein, Effector interaction Visualizaton of GPCR, G-protein, Effector interaction at protein level